- SLC38A10 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-81194
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: MKPKQVSRDL GLAADLPGGA EGAAAQPQAV LRQPELRVIS DGEQGGQQGH RLDHGGHLEM RKA
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- SLC38A10
- solute carrier family 38 member 10
- IHC, IHC-p
- PP1744, SNAT10
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- PBS (pH 7.2) and 40% Glycerol
Sequence
MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA
Specifications/Features
Available conjugates: Unconjugated